FGF2

FGF2
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1BAS, 1BFB, 1BFC, 1BFF, 1BFG, 1BLA, 1BLD, 1CVS, 1EV2, 1FGA, 1FQ9, 1II4, 1IIL, 2BFH, 2FGF, 2M49, 4FGF, 4OEE, 4OEF, 4OEG

Ідентифікатори
Символи FGF2, BFGF, FGF-2, FGFB, HBGF-2, fibroblast growth factor 2
Зовнішні ІД OMIM: 134920 MGI: 95516 HomoloGene: 1521 GeneCards: FGF2
Онтологія гена
Молекулярна функція

• cytokine activity
• heparin binding
• fibroblast growth factor receptor binding
• GO:0001948, GO:0016582 protein binding
• nuclear receptor coactivator activity
• chemoattractant activity
• growth factor activity
• protein tyrosine kinase activity
• phosphatidylinositol-4,5-bisphosphate 3-kinase activity
• 1-phosphatidylinositol-3-kinase activity
• receptor-receptor interaction
• integrin binding

Клітинна компонента

• extracellular region
• клітинне ядро
• міжклітинний простір

Біологічний процес

• release of sequestered calcium ion into cytosol
• диференціація клітин
• negative regulation of fibroblast migration
• hyaluronan catabolic process
• positive regulation of endothelial cell proliferation
• positive regulation of MAP kinase activity
• negative regulation of blood vessel endothelial cell migration
• positive regulation of endothelial cell chemotaxis to fibroblast growth factor
• somatic stem cell population maintenance
• positive regulation of phospholipase C activity
• extracellular matrix organization
• Загоєння ран
• negative regulation of cell death
• regulation of angiogenesis
• нейробіологія розвитку
• cell migration involved in sprouting angiogenesis
• MAPK cascade
• positive regulation of angiogenesis
• positive regulation of phosphatidylinositol 3-kinase activity
• GO:0060469, GO:0009371 positive regulation of transcription, DNA-templated
• хемотаксис
• fibroblast growth factor receptor signaling pathway
• chondroblast differentiation
• multicellular organism development
• growth factor dependent regulation of skeletal muscle satellite cell proliferation
• branching involved in ureteric bud morphogenesis
• positive regulation of cardiac muscle cell proliferation
• embryonic morphogenesis
• Ангіогенез
• positive regulation of cell fate specification
• animal organ morphogenesis
• regulation of endothelial cell chemotaxis to fibroblast growth factor
• phosphatidylinositol biosynthetic process
• inositol phosphate biosynthetic process
• negative regulation of wound healing
• Ras protein signal transduction
• positive regulation of cell division
• GO:0072468 сигнальна трансдукція
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
• positive chemotaxis
• phosphatidylinositol phosphate biosynthetic process
• peptidyl-tyrosine phosphorylation
• positive regulation of sprouting angiogenesis
• positive regulation of cell population proliferation
• phosphatidylinositol-3-phosphate biosynthetic process
• stem cell proliferation
• regulation of signaling receptor activity
• positive regulation of protein kinase B signaling
• cytokine-mediated signaling pathway
• positive regulation of blood vessel endothelial cell migration
• positive regulation of ERK1 and ERK2 cascade
• positive regulation of vascular associated smooth muscle cell proliferation
• positive regulation of vascular endothelial cell proliferation
• positive regulation of cell migration involved in sprouting angiogenesis
• paracrine signaling
• positive regulation of DNA biosynthetic process
• positive regulation of endothelial cell chemotaxis

Джерела:Amigo / QuickGO
Шаблон експресії


Більше даних
Ортологи
Види Людина Миша
Entrez
2247
14173
Ensembl
ENSG00000138685
ENSMUSG00000037225
UniProt
P09038
P15655
RefSeq (мРНК)
NM_002006
NM_001361665
NM_008006
RefSeq (білок)
NP_001997
NP_001348594
NP_032032
Локус (UCSC) Хр. 4: 122.83 – 122.9 Mb Хр. 3: 37.4 – 37.46 Mb
PubMed search [1] [2]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

FGF2 (англ. Fibroblast growth factor 2) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 4-ї хромосоми.[3] Довжина поліпептидного ланцюга білка становить 288 амінокислот, а молекулярна маса — 30 770[4].

Послідовність амінокислот
1020304050
MVGVGGGDVEDVTPRPGGCQISGRGARGCNGIPGAAAWEAALPRRRPRRH
PSVNPRSRAAGSPRTRGRRTEERPSGSRLGDRGRGRALPGGRLGGRGRGR
APERVGGRGRGRGTAAPRAAPAARGSRPGPAGTMAAGSITTLPALPEDGG
SGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAE
ERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRS
RKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS

Кодований геном білок за функціями належить до факторів росту, мітогенів, білків розвитку, фосфопротеїнів. Задіяний у таких біологічних процесах як ангіогенез, диференціація. Білок має сайт для зв'язування з молекулою гепарину. Локалізований у ядрі. Також секретований назовні.

Рекомбінантний людський FGF2 (трафермін) є лікарським засобом, що використовується для лікування виразок та опіків.

Література

  • Kurokawa T., Sasada R., Iwane M., Igarashi K. (1987). Cloning and expression of cDNA encoding human basic fibroblast growth factor. FEBS Lett. 213: 189—194. PMID 2435575 DOI:10.1016/0014-5793(87)81489-8
  • Gimenez-Gallego G., Conn G., Hatcher V.B., Thomas K.A. (1986). Human brain-derived acidic and basic fibroblast growth factors: amino terminal sequences and specific mitogenic activities. Biochem. Biophys. Res. Commun. 135: 541—548. PMID 3964259 DOI:10.1016/0006-291X(86)90028-8
  • Gautschi P., Frater-Schroeder M., Boehlen P. (1986). Partial molecular characterization of endothelial cell mitogens from human brain: acidic and basic fibroblast growth factors. FEBS Lett. 204: 203—207. PMID 3732516 DOI:10.1016/0014-5793(86)80812-2
  • Goretzki L., Burg M.A., Grako K.A., Stallcup W.B. (1999). High-affinity binding of basic fibroblast growth factor and platelet-derived growth factor-AA to the core protein of the NG2 proteoglycan. J. Biol. Chem. 274: 16831—16837. PMID 10358027 DOI:10.1074/jbc.274.24.16831
  • Skjerpen C.S., Wesche J., Olsnes S. (2002). Identification of ribosome-binding protein p34 as an intracellular protein that binds acidic fibroblast growth factor. J. Biol. Chem. 277: 23864—23871. PMID 11964394 DOI:10.1074/jbc.M112193200
  • Eswarakumar V.P., Lax I., Schlessinger J. (2005). Cellular signaling by fibroblast growth factor receptors. Cytokine Growth Factor Rev. 16: 139—149. PMID 15863030 DOI:10.1016/j.cytogfr.2005.01.001

Примітки

  1. ↑ Human PubMed Reference:.
  2. ↑ Mouse PubMed Reference:.
  3. ↑ HUGO Gene Nomenclature Commitee, HGNC:3676 (англ.) . Процитовано 30 серпня 2017.
  4. ↑ UniProt, P09038 (англ.) . Архів оригіналу за 20 серпня 2017. Процитовано 30 серпня 2017.

Див. також

  • Хромосома 4

П:  Портал «Біологія» П:  Портал «Хімія»


Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.